PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G382000.1.p
Common NameSETIT_021159mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family CPP
Protein Properties Length: 772aa    MW: 83355.5 Da    PI: 7.248
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G382000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.77.5e-16459497240
                 TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                         ++k+C+CkkskClk+YCeCfaag++Cse C+C++C N+e
  Seita.3G382000.1.p 459 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCTCQGCLNNE 497
                         689**********************************98 PP

2TCR521.4e-16544582139
                 TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                         ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Seita.3G382000.1.p 544 RHKRGCNCKKSSCLKKYCECFQGGVGCSISCRCEGCKNA 582
                         589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-17458499IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.802459584IPR005172CRC domain
PfamPF036381.5E-11461497IPR005172CRC domain
SMARTSM011142.5E-17544585IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.7E-12546582IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MDTPDRPRAA AAAGFEDSPV FNFINNLSPI PPPKPSDRAH NVQLFKSSDL APVSSIFASP  60
HVNPAKEPKI LIRDDSVQLP QELHSPSSVR TRVGSSITFR MIRCRDIVSE NCNTTCRLNE  120
ASIDSSDHTS NSESQLPQST QNGVGSVETN KDQCADGKTD LTISQECTDL EGMNLDESGP  180
DKMDSSHSGI DLHENQLSEQ NKDEPAAYNG DYMITNQPCG DMLTLGLPFG TETQSVNDTQ  240
KAENSYPGKS LMNEESSDHY TQNSAHEPHH YWTGAVEGAA VNYTPQALPG ALQSQLMPCN  300
KLNEPRDYMP TEQNALSQHL RGMRRRSLFN EKAGASNKGV DKASDHHSVN STTPKCKTIS  360
GDINSKPLRT PPCALPGIGL HLNALAAIPK EKIVSRDIHS TINESSSLPC PAGSSPLPYE  420
QNIINDDFAQ TTDIVSAEPS SQGSPKKKRH KFDNGDGTSC KRCSCKKSKC LKLYCECFAA  480
GVYCSEPCTC QGCLNNEIHM ETVLSTRQQI ESRNPLAFAP KVIHTSEPGL ELGDFNNKTP  540
ASARHKRGCN CKKSSCLKKY CECFQGGVGC SISCRCEGCK NAFGRREGVA ALSIEEPKQA  600
SEESNACVKE EKCEIDKQLV IYQATDLAAA ENLLTTPSMV ECRPLACLPP PSSKKPSSKK  660
PRSSAKSGNP SRLCNSQAPL KTDILLAQFG NYAEMVLGDS TTDTLKGNSS PQTSVKVVSP  720
NKKRVSPPRM GTGLSPICKS GRKLILKSIP SFPSLGGDFN NEDSKSKAPA P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963116.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLK3Z3P10.0K3Z3P1_SETIT; Uncharacterized protein
STRINGSi021159m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP127462630
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-75TESMIN/TSO1-like CXC 2